PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG004566.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YA
Protein Properties Length: 353aa    MW: 38419.3 Da    PI: 8.9953
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG004566.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA95.36.9e-30158213258
    CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   p+YVNaKQy++I++RR++Rak++ ++kl  ++rkpy+h SRh hA+rRpRg+gGrF
  CCG004566.1 158 VPIYVNAKQYHGIIRRRKSRAKAALDNKL-PRNRKPYMHRSRHLHAMRRPRGCGGRF 213
                  59***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-34155216IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.173156216IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.8E-26159213IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-22159181IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.7E-22190213IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MAMKTFYFKE HEGSVHNPNG QLSTVPWWTA FGSQAVNGES CGLLKALPIE QPAGRGETAT  60
KHARMGTEQG LDKANITQFT IFPGDCKPSG GEQKSVQGAI SVQTALPDYY AHFDLGFGQP  120
VICAKYPVVD QYYGLFSTFG PQISGRIMLP MSTTTDDVPI YVNAKQYHGI IRRRKSRAKA  180
ALDNKLPRNR KPYMHRSRHL HAMRRPRGCG GRFLNTKELN DGKGITEAKK AGDFQLLQPT  240
GSQSSEVLES GGATLNSSME ANCGGSNLSG SEVTSLYNRG DFNRFPFNHH GLTVHGFSGM  300
DGGHGIGMPS KWIAAADNCS NLKQQGNGLG WCLHHAQDQT PPPLLEPDNQ ILA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-18159218463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2101320.0AC210132.1 Populus trichocarpa clone POP011-D09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046434.10.0PREDICTED: nuclear transcription factor Y subunit A-10 isoform X1
TrEMBLU5G8I20.0U5G8I2_POPTR; Uncharacterized protein
STRINGPOPTR_0006s21640.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.22e-52nuclear factor Y, subunit A10